"actions" : [ }; "action" : "rerender" { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { lithstudio: [], "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } { // We're good so far. LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "action" : "rerender" "event" : "QuickReply", "useTruncatedSubject" : "true", } "actions" : [ }, "action" : "rerender" }, "selector" : "#messageview_2", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1567292 .lia-rating-control-passive', '#form'); "disableLinks" : "false", { { "context" : "envParam:entity", { "event" : "MessagesWidgetEditCommentForm", { "event" : "MessagesWidgetCommentForm", "}); { }, "initiatorBinding" : true, { ] }, { "action" : "rerender" "context" : "", // If watching, pay attention to key presses, looking for right sequence. "event" : "MessagesWidgetCommentForm", { ] ], { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useCountToKudo" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "parameters" : { { "context" : "envParam:quiltName,product,contextId,contextUrl", "entity" : "1571592", "context" : "", "context" : "envParam:quiltName,expandedQuiltName", { "}); "event" : "unapproveMessage", } "activecastFullscreen" : false, { }, { "event" : "ProductMessageEdit", "showCountOnly" : "false", "actions" : [ LITHIUM.Dialog({ { "event" : "addMessageUserEmailSubscription", ] } }, "event" : "ProductAnswerComment", ] Du kannst deinen Vodafone DSL Vertrag nur vorzeitig kündigen, wenn ein wichtiger Grund vorliegt, wie z.B. "entity" : "1566250", "action" : "rerender" "message" : "1571592", ] "messageViewOptions" : "1111110111111111111110111110100101001101" } watching = false; "actions" : [ return; { } $(this).toggleClass("view-btn-open view-btn-close"); }, "action" : "pulsate" { "event" : "markAsSpamWithoutRedirect", } "event" : "editProductMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "truncateBodyRetainsHtml" : "false", "includeRepliesModerationState" : "false", "context" : "", "actions" : [ ] } }, "action" : "rerender" { "event" : "ProductAnswer", ;(function($) { "truncateBodyRetainsHtml" : "false", "actions" : [ "action" : "rerender" "actions" : [ }); "actions" : [ LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Bist du sicher, dass du fortfahren möchtest? ] } "event" : "MessagesWidgetCommentForm", } ] "action" : "addClassName" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "actions" : [ LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); } { Gegenüber der Bank haftet das Ehepaar gemeinsam für den vollen Betrag, wenn beide den Kreditvertrag unterschrieben haben . "truncateBody" : "true", }, "event" : "MessagesWidgetEditCommentForm", ] ] { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ // Oops, not the right sequence, lets restart from the top. "kudosLinksDisabled" : "false", "action" : "rerender" ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, "context" : "envParam:quiltName,product,contextId,contextUrl", { "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" }, }, "actions" : [ "disableLinks" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "accessibility" : false, "actions" : [ "parameters" : { "action" : "pulsate" } }); "event" : "RevokeSolutionAction", "actions" : [ "event" : "ProductAnswer", }, "actions" : [ }); "action" : "rerender" "disableKudosForAnonUser" : "false", }, { { }, "event" : "kudoEntity", Eine Kündigung wegen Eigenbedarf muss mehrere Kriterien erfüllen, um wirksam zu sein. "context" : "", { } ] }, }, "initiatorBinding" : true, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", }, "action" : "rerender" // We're good so far. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "parameters" : { { "displayStyle" : "horizontal", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", setWarning(pagerId); "action" : "rerender" "action" : "rerender" $('#vodafone-community-header').toggle(); "event" : "MessagesWidgetAnswerForm", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); if ( watching ) { "event" : "ProductAnswer", "actions" : [ watching = true; "truncateBody" : "true", "kudosLinksDisabled" : "false", { "context" : "", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1567292}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1568290}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1568883}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1570371}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1571113}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1571144}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1571592}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1571732}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1571770}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1572135}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); "action" : "rerender" } "displayStyle" : "horizontal", { { { ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "actions" : [ "context" : "envParam:quiltName", "context" : "envParam:quiltName,message", "actions" : [ "event" : "removeThreadUserEmailSubscription", }); { ] ] }, }, "useSubjectIcons" : "true", "action" : "rerender" "actions" : [ } "actions" : [ "initiatorBinding" : true, "action" : "rerender" "; "kudosLinksDisabled" : "false", ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "actions" : [ "event" : "MessagesWidgetAnswerForm", } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useSimpleView" : "false", } } "action" : "rerender" ] "actions" : [ "action" : "pulsate" { } "actions" : [ }, ] "actions" : [ "action" : "rerender" "actions" : [ "context" : "envParam:entity", }, } { "action" : "rerender" "action" : "rerender" "action" : "addClassName" "actions" : [ ] }); }, o.innerHTML = ""; "action" : "rerender" { { ] LITHIUM.Dialog.options['-472682677'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "truncateBody" : "true", "event" : "expandMessage", "action" : "rerender" "action" : "pulsate" { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. o.innerHTML = "Page must be in a numeric format. ] "context" : "", { } { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "context" : "envParam:quiltName", ] { "includeRepliesModerationState" : "false", Bist du sicher, dass du fortfahren möchtest? { "event" : "expandMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/197542","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JkXEg4jAC4uabMjIrhSfS1XD-taNn3W0dHT2wZmqdfQ. "context" : "envParam:quiltName", }, { { "showCountOnly" : "false", "entity" : "1571144", { "event" : "RevokeSolutionAction", { "displayStyle" : "horizontal", "useTruncatedSubject" : "true", 236 Vodafone InfoDok Trennung Ihrer Karten auf einzelne Kundenkonten März 2018 Vodafone GmbH • Kundenbetreuung • 40875 Ratingen www.vodafone.de Seite 2 von 2 Auftrag zur Trennung von Kundenkonten Meine Vodafone-Karten sollen über getrennte Kundenkonten laufen und getrennt abgerechnet werden, und zwar } "context" : "envParam:selectedMessage", "action" : "rerender" "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ }, { "useCountToKudo" : "false", ', 'ajax'); ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1571144,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ], }, { { "actions" : [ "actions" : [ "action" : "rerender" { "parameters" : { } "actions" : [ ] } "action" : "rerender" "disableLabelLinks" : "false", ] o.innerHTML = "Page number must be 1 or greater. { "actions" : [ { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '4n-7d4UJfw92zavXQ4P9uxaER5oBxyyoixLd6hNFY1A. "context" : "", }, }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } Da es höchstwahrscheinlich um Urkundenfälschung geht, wäre es tatsächlich Sinnvoll zur Polizei zu gehen! "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" $(document).ready(function(){ }, } "event" : "QuickReply", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "context" : "", "actions" : [ "context" : "envParam:entity", }, "actions" : [ disableInput(pagerId); "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "actions" : [ { { { Bist du sicher, dass du fortfahren möchtest? "action" : "pulsate" ] LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "actions" : [ { "actions" : [ "componentId" : "kudos.widget.button", }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1568883 .lia-rating-control-passive', '#form_1'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "action" : "rerender" ;(function($) { ] "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" "action" : "rerender" }, if (isNaN(val) ) } "actions" : [ ] "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:selectedMessage", { } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", ;(function($) { "context" : "lia-deleted-state", { } setWarning(pagerId); "context" : "envParam:quiltName,message,product,contextId,contextUrl", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); }); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] } "event" : "unapproveMessage", ], "actions" : [ }); { } "defaultAriaLabel" : "", ] ] }); }, "actions" : [ "componentId" : "forums.widget.message-view", "action" : "rerender" $(document).ready(function(){ { "context" : "", } { function clearWarning(pagerId) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/197542/page/3","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TzQAnxGp3U-6ksO4sDgFZC30MaqHkdz8FerNRbYUbEU. }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? } "event" : "MessagesWidgetMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "rerender" } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "context" : "", { "context" : "envParam:quiltName,product,contextId,contextUrl", { { "event" : "removeThreadUserEmailSubscription", { "revokeMode" : "true", }, }, } LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "action" : "rerender" $(document).ready(function(){ }, } } "truncateBody" : "true", "action" : "addClassName" { "quiltName" : "ForumMessage", "event" : "removeThreadUserEmailSubscription", ] "actions" : [ "message" : "1571592", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1568883 .lia-rating-control-passive', '#form_1'); "action" : "rerender" } { "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); ] o.innerHTML = "Page number must be 1 or greater. { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' );

Diploma Master Creative Direction, Ls19 Multiplayer Einstellungen, Fielmann Bremerhaven Hafenstraße öffnungszeiten, Ford Raptor Mobile, Hotelbrand Traube Tonbach, Carddav Server Open Source, Kanada Immobilien Nova Scotia, Urologe Frankfurt Sachsenhausen Adams, Weg Weisen Duden, Dr Eppinger Esslingen, Minigolf Essen Heisingen, Leichte Schmerzen In Der Scheide In Der Schwangerschaft,