} { "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ watching = false; } "event" : "ProductMessageEdit", "actions" : [ "action" : "pulsate" ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", { "action" : "rerender" { "entity" : "2046183", "context" : "envParam:selectedMessage", "event" : "markAsSpamWithoutRedirect", { ] "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'I32GG0XE0sa_IrMoaDEx4USle5xYDmxBDChkNout_WE. "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" } return false; } } } ] ] { "event" : "ProductAnswer", "event" : "AcceptSolutionAction", watching = false; "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "action" : "rerender" } { "actions" : [ ;(function($) { function setWarning(pagerId) { "context" : "", } "event" : "MessagesWidgetEditCommentForm", } "event" : "ProductMessageEdit", "}); "linkDisabled" : "false" "useSubjectIcons" : "true", } Wer oder was bucht unrechtmäßig Geld von meiner Pr... Diesen Thema für aktuellen Benutzer floaten. "actions" : [ { "actions" : [ "action" : "rerender" "initiatorBinding" : true, "actions" : [ } "selector" : "#messageview_3", { }); "action" : "rerender" // We made it! "selector" : "#kudosButtonV2_4", "event" : "MessagesWidgetAnswerForm", "event" : "ProductAnswerComment", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2046122 .lia-rating-control-passive', '#form_3'); "event" : "RevokeSolutionAction", }, ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "event" : "MessagesWidgetMessageEdit", }); if ( Number(val) > 2 ) } "action" : "rerender" "action" : "rerender" "context" : "", "actions" : [ { if ( watching ) { "selector" : "#messageview_4", ] "event" : "removeThreadUserEmailSubscription", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } ctaHTML += 'Stell Deine Frage'; "event" : "MessagesWidgetEditCommentForm", "event" : "editProductMessage", } "disableKudosForAnonUser" : "false", "event" : "unapproveMessage", "action" : "rerender" }, }, } }, "context" : "", ] "action" : "rerender" "action" : "rerender" ] "truncateBody" : "true", "event" : "addThreadUserEmailSubscription", { "actions" : [ "kudosable" : "true", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ZkPt1w70bVnYnYW9_j-MZltg3RNyCNy7pR7VjeTOs7Y. "defaultAriaLabel" : "", } "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } "context" : "envParam:quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-message-uid" if (val.trim() == "") /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'FlszevurHGeSn_BV7MosWItRCPcVt03tFwqcrd1Cmc4. }); LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); o.innerHTML = "Page number must be 1 or greater. "event" : "ProductAnswerComment", ] { ], "event" : "AcceptSolutionAction", } { ], }, Krass. LITHIUM.Loader.runJsAttached(); { } "event" : "MessagesWidgetEditCommentForm", ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", Diese kostet im Regelfall eine Gebühr. Paypal ist inzwischen bei vielen Nutzern ein beliebter Online-Bezahldienst Foto: Getty Images. lithstudio: [], ', 'ajax'); "actions" : [ "disableLabelLinks" : "false", { "context" : "", } ] "activecastFullscreen" : false, var clickHandler = function(event) { ] } }, "event" : "QuickReply", }); { "useTruncatedSubject" : "true", } "event" : "QuickReply", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" watching = true; "context" : "", { ] o.innerHTML = "Page must be in a numeric format. "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "approveMessage", "actions" : [ }, ] }, von meiner prepaid karte wird geld abgebucht, prepaid karte wird geld abgebucht, prepaid karte geld abgezogen, von meinem handy wird geld … ] "event" : "MessagesWidgetEditAction", } { "event" : "removeMessageUserEmailSubscription", { "event" : "MessagesWidgetEditAnswerForm", } } "displaySubject" : "true", } "linkDisabled" : "false" "event" : "expandMessage", { "action" : "rerender" "event" : "ProductMessageEdit", ], "context" : "", }); "useCountToKudo" : "false", "disableLinks" : "false", "context" : "", { "actions" : [ }, ] ] "action" : "rerender" { } "action" : "rerender" { { } "context" : "", "action" : "rerender" { ] LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($) { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "actions" : [ "context" : "", "}); "context" : "envParam:quiltName", }, { { { } "event" : "RevokeSolutionAction", "actions" : [ } "event" : "ProductAnswerComment", "context" : "envParam:feedbackData", "action" : "rerender" { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); ] ] }, "actions" : [ Execute whatever should happen when entering the right sequence } "action" : "rerender" "event" : "ProductAnswerComment", "actions" : [ { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2046183 .lia-rating-control-passive', '#form_5'); { { "actions" : [ }); ] } } { "context" : "", Weitere Infos findest du zum Thema ungewollte Abos/Einzelkäufe bin Drittanbietern auch in diesem Thread. ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ;(function($) { "action" : "rerender" { "initiatorBinding" : true, "action" : "rerender" "event" : "editProductMessage", { "event" : "approveMessage", { "useSubjectIcons" : "true", "event" : "unapproveMessage", ] "message" : "2046183", "actions" : [ var keycodes = { "context" : "envParam:quiltName,product,contextId,contextUrl", ;(function($) { "actions" : [ if (doChecks(pagerId, val)) "includeRepliesModerationState" : "false", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.ComponentEvents.set({ { } Das korrigiert nicht nur die Nutzerzahlen, sondern wird auch dem Datenschutz gerecht. zu 1: hängt von deinem Kartentyp ab. "quiltName" : "ForumMessage", "actions" : [ { "actions" : [ "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:selectedMessage", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); clearWarning(pagerId); }, ;(function($) { { { { ] "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045283 .lia-rating-control-passive', '#form_0'); "useTruncatedSubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); } Erfolgt in diesem Zeitraum keine erneute Aufladung, wird die Karte gesperrt und ein eventuell noch bestehendes Guthaben abgebucht. ] "message" : "2046206", }, } { } { "quiltName" : "ForumMessage", "action" : "rerender" "context" : "", "event" : "unapproveMessage", }, ] "action" : "rerender" "}); { "event" : "ProductAnswer", ] } } ] }); "useSubjectIcons" : "true", "action" : "rerender" } { }, } "event" : "addMessageUserEmailSubscription", ] "eventActions" : [ }, { }, '; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "displaySubject" : "true", { { } "messageViewOptions" : "1111110111111111111110111110100101001101" "messageViewOptions" : "1111110111111111111110111110100101001101" ] "actions" : [ "action" : "rerender" { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, } "action" : "rerender" }, "useSimpleView" : "false", ] { } "initiatorBinding" : true, "actions" : [ "action" : "rerender" "event" : "kudoEntity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } "actions" : [ { function processPageInputBlur(pagerId, val) } setWarning(pagerId); ] "context" : "envParam:selectedMessage", o.innerHTML = "Page number can\'t exceed 2. { { var key = e.keyCode; }, "actions" : [ ] "actions" : [ { ] Ich hatte also über Nacht plötzlich nur noch die Hälfte von meinem Guthaben auf dem Handy obwohl ich keine SMS geschrieben habe und auch nicht Telefoniert habe. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, { "actions" : [ { "action" : "rerender" ] ], } "triggerEvent" : "click", "context" : "envParam:entity", setWarning(pagerId); } } ] "event" : "deleteMessage", "actions" : [ "event" : "deleteMessage", "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetEditAction", "event" : "addThreadUserEmailSubscription", } }, "context" : "", }, { "action" : "rerender" "useCountToKudo" : "false", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); } "truncateBody" : "true", "action" : "rerender" window.onclick = function(event) { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "event" : "ProductMessageEdit", "action" : "addClassName" } // just for convenience, you need a login anyways... LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_14ba1ecb7d1408","tooltipContentSelector":"#link_14ba1ecb7d1408_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_14ba1ecb7d1408_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" } "event" : "ProductAnswerComment", }, } LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" }, { { ] "event" : "RevokeSolutionAction", "context" : "", "actions" : [ { count++; "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", ] ], "context" : "", ] }); "action" : "rerender" } lithstudio: [], "action" : "rerender" "showCountOnly" : "false", lithstudio: [], "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "includeRepliesModerationState" : "false", }, ] "messageViewOptions" : "1111110111111111111110111110100101001101" disableInput(pagerId); { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } ] ] "displayStyle" : "horizontal", "action" : "rerender" event.preventDefault(); "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" ], "event" : "RevokeSolutionAction", { LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "}); ] "actions" : [ "displayStyle" : "horizontal", o.innerHTML = ""; "actions" : [ }, } "actions" : [ o.innerHTML = ""; "event" : "removeMessageUserEmailSubscription", "parameters" : { { "action" : "rerender" "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" }, "disableLinks" : "false", ] "event" : "ProductAnswer", "actions" : [ return false; } > 0) ) "actions" : [ "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "event" : "MessagesWidgetEditAction", "}); "action" : "rerender" { "context" : "envParam:entity", "action" : "addClassName" }, "messageViewOptions" : "1111110111111111111110111110100101011101" "event" : "MessagesWidgetAnswerForm", "displaySubject" : "true", "parameters" : { ] "actions" : [ ] }, } }, "action" : "pulsate" "useTruncatedSubject" : "true", MMS) vorliegen. "actions" : [ }, { } { "disableLabelLinks" : "false", "context" : "envParam:quiltName", "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'FP5fVbmpF-cJLXUoHtdVZgQD95j-tXM0rQyjy9CS3Z8. "kudosLinksDisabled" : "false", }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,message", { { "event" : "editProductMessage", "event" : "MessagesWidgetEditCommentForm", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "event" : "addMessageUserEmailSubscription", ] { "event" : "ProductAnswer", "action" : "rerender" { "action" : "rerender" "actions" : [ "event" : "editProductMessage", "event" : "MessagesWidgetEditAction", }, "actions" : [ ] function clearWarning(pagerId) { "event" : "unapproveMessage", })(LITHIUM.jQuery); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { "; { }, "actions" : [ "disableKudosForAnonUser" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2046203,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "event" : "unapproveMessage", "; { "context" : "", "componentId" : "kudos.widget.button", var count = 0; return; ] } }); { }, ] "action" : "addClassName" }, "context" : "", if (1 != val) "action" : "rerender" "event" : "QuickReply", { "action" : "pulsate" "linkDisabled" : "false" "disableLabelLinks" : "false", } ] { "event" : "kudoEntity", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "pulsate" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); ] { } { ] if ( count == neededkeys.length ) { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetMessageEdit", "actions" : [ { "action" : "rerender" "action" : "rerender" // console.log(key); ;(function($) { ] "event" : "MessagesWidgetEditCommentForm", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { { }, "event" : "ProductAnswerComment", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7y_YLJOOw9yB3srcKJhR5k3-cU-xxRFtItej3j1vhH8. "event" : "removeMessageUserEmailSubscription", { "context" : "lia-deleted-state", } "context" : "", "event" : "approveMessage", } "quiltName" : "ForumMessage", { ] if ( key == neededkeys[0] ) { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" { { } } { "actions" : [ "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); { "actions" : [ }); ] "componentId" : "forums.widget.message-view", $(document).ready(function(){ ] Bei einer Prepaid-Karte wird die Kreditkarte aufgeladen, indem Sie Geld auf die Kreditkarte überweisen. { ] { "disableLabelLinks" : "false", } "useCountToKudo" : "false", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { }, "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); { "parameters" : { ] "event" : "removeMessageUserEmailSubscription", } clearWarning(pagerId); "actions" : [ { ] ] { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); watching = true; ] "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:selectedMessage", { function clearWarning(pagerId) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":657,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBA1taA1ICCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUVlUGBFcGVBQGVwFTSQEAAFBIVFUPV08EVgJTUgQFAFBVAQZAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}. "truncateBody" : "true", ] }, { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); '; { "event" : "MessagesWidgetCommentForm", "action" : "pulsate" ] ] "useCountToKudo" : "false", "kudosLinksDisabled" : "false", "actions" : [ "}); var key = e.keyCode; { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", "message" : "2046203", // just for convenience, you need a login anyways... "action" : "pulsate" "displaySubject" : "true", ] }, "actions" : [ "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); { { "disallowZeroCount" : "false", ;(function($) { { $(document).ready(function(){ "context" : "envParam:quiltName,product,contextId,contextUrl", Februar 2020, 17:23 Uhr. { $(document).ready(function(){ "actions" : [ { } { resetMenu(); "accessibility" : false, }, "initiatorBinding" : true, "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", { } "context" : "",

Stadtbibliothek Bielefeld Ausweis Verlängern, Stadt Am Hellweg Nordrhein-westfalen 5 Buchstaben, Pizzeria Winnenden Hertmannsweiler, Amphitheater Trier Bau, Fahrzeugtechnik Studium Praktikum, Lehre Buddhas Kreuzworträtsel, Internet Trennt Sich Ständig, Crossfit Klimmzüge Lernen, Falkensteiner Club Funimation Borik Günstig Buchen,